PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN47436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 506aa    MW: 56669.5 Da    PI: 8.8189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN47436.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-1657103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg WT+e+d+ l +av+ + g++Wk+Ia+ ++ g+++ qc +rwqk+l
       KHN47436.1  57 RGGWTEEDDDTLTNAVQVFNGKNWKKIAEFLP-GKSEVQCLHRWQKVL 103
                      789*****************************.************986 PP

2Myb_DNA-binding58.31.7e-18109155148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++++ v  +G++ W++I++ ++ gR +kqc++rw ++l
       KHN47436.1 109 KGPWTQEEDDKIIEMVSTHGPKKWSLISKSLP-GRIGKQCRERWCNHL 155
                      79******************************.*************96 PP

3Myb_DNA-binding56.56.2e-18161204146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT+eE++ l da++ +G++ W+ Ia+ +  gRt++++k++w++
       KHN47436.1 161 KDPWTQEEELALMDAHRIHGNK-WAEIAKVLH-GRTDNSIKNHWNS 204
                      689*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.75652103IPR017930Myb domain
SuperFamilySSF466897.18E-1555110IPR009057Homeodomain-like
SMARTSM007176.3E-1456105IPR001005SANT/Myb domain
PfamPF002492.3E-1457103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2059115IPR009057Homeodomain-like
CDDcd001675.91E-1260103No hitNo description
PROSITE profilePS5129430.991104159IPR017930Myb domain
SuperFamilySSF466893.37E-31106202IPR009057Homeodomain-like
SMARTSM007171.1E-17108157IPR001005SANT/Myb domain
CDDcd001674.66E-15111155No hitNo description
PfamPF139219.6E-19112170No hitNo description
Gene3DG3DSA:1.10.10.601.5E-27116161IPR009057Homeodomain-like
SMARTSM007172.1E-16160208IPR001005SANT/Myb domain
PROSITE profilePS5129422.526160210IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-24162210IPR009057Homeodomain-like
CDDcd001676.39E-12163206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MAEEKSEQHC SENKQTNANS SSSVSEGSGS AMPKSSTERK SALPSNRRTT GPVRRARGGW  60
TEEDDDTLTN AVQVFNGKNW KKIAEFLPGK SEVQCLHRWQ KVLHPELVKG PWTQEEDDKI  120
IEMVSTHGPK KWSLISKSLP GRIGKQCRER WCNHLNPDIK KDPWTQEEEL ALMDAHRIHG  180
NKWAEIAKVL HGRTDNSIKN HWNSSLKKKM NFYLATGRLP PIVSSSKTTD INLGNSDKNQ  240
LESSETVREF GDSSNVPAKG SADSDCIECN RSSNKGFSCS NLEPVFGDYF RINSEPKFEN  300
PGLNDNPRVD HCMSNGEKKS CSLTRNFYSK ESQTLGSFCY EPTLPLDSYY SNISGLQQNE  360
LFASPMMSSV GYLTPPPVKG SELCSESPES ILKKAAKTFP TPSILRKRSV VKRPVTPSAV  420
AKGVNDSHAY NEQERTNDIT GSEVVRLPVS PVNNCYGSNI PHNKAFNTTS PYRSRSRQTA  480
IKCLEKQLDF AFEKEKHARK MKKCDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-63602109159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-63602109159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522206.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A0B2SL770.0A0A0B2SL77_GLYSO; Myb-related protein 3R-1
STRINGGLYMA03G19470.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-121myb domain protein 3r-5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]